Recombinant Human POLR3A protein, His-tagged

• Cat.No.: POLR3A-5353H
• Product Overview: Recombinant Human POLR3A protein(O14802)(392-632aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Protein length: 392-632aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 31.4 kDa
• AASequence: FPEKVNKANINFLRKLVQNGPEVHPGANFIQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQIFSVILRPSDDNPVRANLRTKGKQYCGKGEDLC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: POLR3A polymerase (RNA) III (DNA directed) polypeptide A, 155kDa [ Homo sapiens ]
• Official Symbol: POLR3A
• Synonyms: POLR3A; polymerase (RNA) III (DNA directed) polypeptide A, 155kDa; DNA-directed RNA polymerase III subunit RPC1; hRPC155; RPC1; RPC155; RNA polymerase III subunit C1; RNA polymerase III subunit C160; RNA polymerase III 155 kDa subunit; RNA polymerase III subunit RPC155-D; DNA-directed RNA polymerase III subunit A; DNA-directed RNA polymerase III largest subunit; ADDH; HLD7
• Gene ID: 11128
• mRNA Refseq: NM_007055
• Protein Refseq: NP_008986
• MIM: 614258
• UniProt ID: O14802