Recombinant Human POLR2F protein, GST-tagged

Cat.No. : POLR2F-1844H
Product Overview : Recombinant Human POLR2F protein(1-127 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-127 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol POLR2F
Synonyms POLR2F; polymerase (RNA) II (DNA directed) polypeptide F; DNA-directed RNA polymerases I, II, and III subunit RPABC2; DNA directed RNA polymerase II 14.4 kda polypeptide; HRBP14.4; RPB6; RPC15; RPABC14.4; RPB6 homolog; RNA Polymerase II subunit 14.4 kD; DNA-directed RNA polymerase II subunit F; RNA polymerases I, II, and III subunit ABC2; DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide; POLRF; RPABC2; RPB14.4;
Gene ID 5435
mRNA Refseq NM_021974
Protein Refseq NP_068809
MIM 604414
UniProt ID P61218

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All POLR2F Products

Required fields are marked with *

My Review for All POLR2F Products

Required fields are marked with *

0

Inquiry Basket

cartIcon