Recombinant Human POLG

• Cat.No.: POLG-28364TH
• Product Overview: Recombinant fragment of Human DNA Polymerase gamma with an N terminal proprietary tag; predicted mwt: 37.73 inclusive of tag.

Specification

• Description: Mitochondrial DNA polymerase is heterotrimeric, consisting of a homodimer of accessory subunits plus a catalytic subunit. The protein encoded by this gene is the catalytic subunit of mitochondrial DNA polymerase. The encoded protein contains a polyglutamine tract near its N-terminus that may be polymorphic. Defects in this gene are a cause of progressive external ophthalmoplegia with mitochondrial DNA deletions 1 (PEOA1), sensory ataxic neuropathy dysarthria and ophthalmoparesis (SANDO), Alpers-Huttenlocher syndrome (AHS), and mitochondrial neurogastrointestinal encephalopathy syndrome (MNGIE). Two transcript variants encoding the same protein have been found for this gene.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: CISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLG LNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERR YGIPQGEALDIYQIIELTKGSLEKRSQPGP
• Sequence Similarities: Belongs to the DNA polymerase type-A family.
• Tag: Non

Gene Information

• Gene Name: POLG polymerase (DNA directed), gamma [ Homo sapiens ]
• Official Symbol: POLG
• Synonyms: POLG; polymerase (DNA directed), gamma; DNA polymerase subunit gamma-1; POLG1; POLGA
• Gene ID: 5428
• mRNA Refseq: NM_001126131
• Protein Refseq: NP_001119603
• MIM: 174763
• Uniprot ID: P54098
• Chromosome Location: 15q24
• Pathway: DNA polymerase gamma complex, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Nucleotide Metabolism, organism-specific biosystem
• Function: DNA binding; DNA-directed DNA polymerase activity; chromatin binding; exonuclease activity; nucleotidyltransferase activity