Recombinant Human POLD4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: POLD4-5944H
• Product Overview: POLD4 MS Standard C13 and N15-labeled recombinant protein (NP_066996) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes the smallest subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein enhances the activity of DNA polymerase delta and plays a role in fork repair and stabilization through interactions with the DNA helicase Bloom syndrome protein. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Molecular Mass: 12.4 kDa
• AA Sequence: MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRWCRAKHMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: POLD4 DNA polymerase delta 4, accessory subunit [ Homo sapiens (human) ]
• Official Symbol: POLD4
• Synonyms: POLD4; polymerase (DNA-directed), delta 4; DNA polymerase delta subunit 4; DNA polymerase delta smallest subunit p12; p12; POLDS
• Gene ID: 57804
• mRNA Refseq: NM_021173
• Protein Refseq: NP_066996
• MIM: 611525
• UniProt ID: Q9HCU8