Recombinant Human POLD2 Protein, His-tagged

Description :	This gene encodes the 50-kDa catalytic subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein is required for the stimulation of DNA polymerase delta activity by the processivity cofactor proliferating cell nuclear antigen (PCNA). Expression of this gene may be a marker for ovarian carcinomas. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5.
Source :	E. coli
Species :	Human
Tag :	His
Form :	Supplied as a 0.2 µM filtered solution of PBS, 10% Glycerol, pH 7.4
Molecular Mass :	52.3kD
AA Sequence :	MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQMRPFLENRAQQHWGSGVGVKKLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHSTQSR
Endotoxin :	Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity :	>95% as determined by SDS-PAGE and Coomassie blue staining

Gene Name	POLD2 polymerase (DNA directed), delta 2, regulatory subunit 50kDa [ Homo sapiens ]
Official Symbol	POLD2
Synonyms	POLD2; polymerase (DNA directed), delta 2, regulatory subunit 50kDa; polymerase (DNA directed), delta 2, regulatory subunit (50kD); DNA polymerase delta subunit 2; DNA polymerase delta subunit p50;
Gene ID	5425
mRNA Refseq	NM_006230
Protein Refseq	NP_006221
MIM	600815
UniProt ID	P49005