Recombinant Human PNPO, His-tagged

• Cat.No.: PNPO-27512TH
• Product Overview: Recombinant fragment corresponding to amino acids 57-261 of Human PNPO with an N terminal His tag; 226 amino acids with tag, Predicted MWt 25.9 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 205 amino acids
• Description: The enzyme encoded by this gene catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine. Mutations in this gene result in pyridoxamine 5-phosphate oxidase (PNPO) deficiency, a form of neonatal epileptic encephalopathy.
• Conjugation: HIS
• Molecular Weight: 25.900kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 0.1mM PMSF, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMDPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP
• Sequence Similarities: Belongs to the pyridoxamine 5-phosphate oxidase family.

Gene Information

• Gene Name: PNPO pyridoxamine 5-phosphate oxidase [ Homo sapiens ]
• Official Symbol: PNPO
• Synonyms: PNPO; pyridoxamine 5-phosphate oxidase; pyridoxine 5 phosphate oxidase; pyridoxine-5-phosphate oxidase; PDXPO
• Gene ID: 55163
• mRNA Refseq: NM_018129
• Protein Refseq: NP_060599
• MIM: 603287
• Uniprot ID: Q9NVS9
• Chromosome Location: 17q21.32
• Pathway: Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of vitamins and cofactors, organism-specific biosystem; Metabolism of water-soluble vitamins and cofactors, organism-specific biosystem; Selenium Pathway, organism-specific biosystem
• Function: FMN binding; oxidoreductase activity, acting on the CH-NH2 group of donors; pyridoxamine-phosphate oxidase activity