Recombinant Human PNPLA8 protein, His-tagged

• Cat.No.: PNPLA8-2904H
• Product Overview: Recombinant Human PNPLA8 protein(100-359 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 100-359 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: CMSRIKSTLNSVSKAVFGNQNEMISRLAQFKPSSQILRKVSDSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENEHFRDKSELEDKKVEEGKLRSPDPGILAYKPGSESVHTVDKPTSPSAIPDVLQVSTKQSIANFLSRPTEGVQALVGGYIGGLVPKLKYDSKSQSEEQEEPAKTDQAVSKDRNAEEKKRLSLQREKIIARVSI
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PNPLA8 patatin-like phospholipase domain containing 8 [ Homo sapiens ]
• Official Symbol: PNPLA8
• Synonyms: PNPLA8; patatin-like phospholipase domain containing 8; calcium-independent phospholipase A2-gamma; IPLA2(GAMMA); IPLA2 2; IPLA2G; PNPLA-gamma; iPLA2 gamma; iPLA2-gamma; patatin-like phospholipase domain-containing protein 8; membrane-associated calcium-independent phospholipase A2 gamma; intracellular membrane-associated calcium-independent phospholipase A2 gamma; IPLA2-2
• Gene ID: 50640
• mRNA Refseq: NM_001256007
• Protein Refseq: NP_001242936
• MIM: 612123
• UniProt ID: Q9NP80