Recombinant Human PNOC protein, His-tagged
Cat.No. : | PNOC-3006H |
Product Overview : | Recombinant Human PNOC protein(24-176 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-176 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | DCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTPCTKVMARSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PNOC prepronociceptin [ Homo sapiens ] |
Official Symbol | PNOC |
Synonyms | PNOC; prepronociceptin; nocistatin; PPNOC; nociceptin; propronociceptin; |
Gene ID | 5368 |
mRNA Refseq | NM_006228 |
Protein Refseq | NP_006219 |
MIM | 601459 |
UniProt ID | Q13519 |
◆ Recombinant Proteins | ||
PNOC-3493R | Recombinant Rhesus monkey PNOC Protein, His-tagged | +Inquiry |
PNOC-4102C | Recombinant Chicken PNOC | +Inquiry |
PNOC-4551R | Recombinant Rat PNOC Protein | +Inquiry |
PNOC-3006H | Recombinant Human PNOC protein, His-tagged | +Inquiry |
PNOC-3311R | Recombinant Rhesus Macaque PNOC Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PNOC-3072HCL | Recombinant Human PNOC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PNOC Products
Required fields are marked with *
My Review for All PNOC Products
Required fields are marked with *
0
Inquiry Basket