Recombinant Human PMM2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PMM2-6090H |
Product Overview : | PMM2 MS Standard C13 and N15-labeled recombinant protein (NP_000294) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene catalyzes the isomerization of mannose 6-phosphate to mannose 1-phosphate, which is a precursor to GDP-mannose necessary for the synthesis of dolichol-P-oligosaccharides. Mutations in this gene have been shown to cause defects in glycoprotein biosynthesis, which manifests as carbohydrate-deficient glycoprotein syndrome type I. |
Molecular Mass : | 27.9 kDa |
AA Sequence : | MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PMM2 phosphomannomutase 2 [ Homo sapiens (human) ] |
Official Symbol | PMM2 |
Synonyms | PMM2; phosphomannomutase 2; CDG1; CDG1a; CDGS; PMM 2; |
Gene ID | 5373 |
mRNA Refseq | NM_000303 |
Protein Refseq | NP_000294 |
MIM | 601785 |
UniProt ID | O15305 |
◆ Recombinant Proteins | ||
PMM2-3351H | Recombinant Human PMM2 protein, GST-tagged | +Inquiry |
PMM2-3302R | Recombinant Rhesus Macaque PMM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PMM2-795C | Recombinant Cynomolgus PMM2 Protein, His-tagged | +Inquiry |
PMM2-538C | Recombinant Cynomolgus Monkey PMM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PMM2-2822H | Recombinant Human Phosphomannomutase 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PMM2-3087HCL | Recombinant Human PMM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PMM2 Products
Required fields are marked with *
My Review for All PMM2 Products
Required fields are marked with *
0
Inquiry Basket