Recombinant Human PLXNA1 Protein (986-1152 aa), His-tagged

• Cat.No.: PLXNA1-1720H
• Product Overview: Recombinant Human PLXNA1 Protein (986-1152 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• ProteinLength: 986-1152 aa
• Description: Coreceptor for SA3A, SA3C, SA3F and SA6D. Necessary for signaling by class 3 saphorins and subsequent rodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Class 3 saphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific saphorins, and its Cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 20.3 kDa
• AA Sequence: LNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPDPVL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: PLXNA1 plexin A1 [ Homo sapiens ]
• Official Symbol: PLXNA1
• Synonyms: PLXNA1; plexin A1; PLXN1; plexin-A1; NOV; plexin 1; NOVP; PLEXIN-A1; DKFZp761P19121
• Gene ID: 5361
• mRNA Refseq: NM_032242
• Protein Refseq: NP_115618
• MIM: 601055
• UniProt ID: Q9UIW2