Recombinant Human PLCG1 protein, GST-tagged

Cat.No. : PLCG1-301472H
Product Overview : Recombinant Human PLCG1 (467-563 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Ala467-His563
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MAEGSAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAGRDGRH
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name PLCG1 phospholipase C, gamma 1 [ Homo sapiens ]
Official Symbol PLCG1
Synonyms PLCG1; phospholipase C, gamma 1; phospholipase C, gamma 1 (formerly subtype 148) , PLC1; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1; NCKAP3; PLC II; PLC148; PLCgamma1; PLC-148; PLC-gamma-1; phospholipase C-II; phospholipase C-148; phosphoinositidase C; phospholipase C-gamma-1; inositoltrisphosphohydrolase; phosphoinositide phospholipase C; phosphatidylinositol phospholipase C; triphosphoinositide phosphodiesterase; phosphoinositide phospholipase C-gamma-1; monophosphatidylinositol phosphodiesterase; 1-phosphatidyl-D-myo-inositol-4,5-bisphosphate; phospholipase C, gamma 1 (formerly subtype 148); 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; PLC1; PLC-II;
Gene ID 5335
mRNA Refseq NM_002660
Protein Refseq NP_002651
MIM 172420
UniProt ID P19174

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PLCG1 Products

Required fields are marked with *

My Review for All PLCG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon