Recombinant Human PLCG1 protein, GST-tagged

• Cat.No.: PLCG1-301472H
• Product Overview: Recombinant Human PLCG1 (467-563 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Ala467-His563
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MAEGSAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAGRDGRH
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: PLCG1 phospholipase C, gamma 1 [ Homo sapiens ]
• Official Symbol: PLCG1
• Synonyms: PLCG1; phospholipase C, gamma 1; phospholipase C, gamma 1 (formerly subtype 148) , PLC1; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1; NCKAP3; PLC II; PLC148; PLCgamma1; PLC-148; PLC-gamma-1; phospholipase C-II; phospholipase C-148; phosphoinositidase C; phospholipase C-gamma-1; inositoltrisphosphohydrolase; phosphoinositide phospholipase C; phosphatidylinositol phospholipase C; triphosphoinositide phosphodiesterase; phosphoinositide phospholipase C-gamma-1; monophosphatidylinositol phosphodiesterase; 1-phosphatidyl-D-myo-inositol-4,5-bisphosphate; phospholipase C, gamma 1 (formerly subtype 148); 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; PLC1; PLC-II
• Gene ID: 5335
• mRNA Refseq: NM_002660
• Protein Refseq: NP_002651
• MIM: 172420
• UniProt ID: P19174