Recombinant Human PLAT therapeutic protein(Alteplase)

• Cat.No.: PLAT-P005H
• Product Overview: Human tissue plasminogen activator, purified, glycosylated, 527 residues purified from CHO cells.

Specification

• Species: Human
• Source: CHO
• Tag: Non
• Protein Length: 527 Aa
• Description: This gene encodes tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding; decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. The expression product is the active ingredient of Activase.
• Molecular Mass: 59KDa
• AA Sequence: SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDF VCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHN YCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKV YTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADI ASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVE KYIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSP FYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLV GIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP
• Endotoxin: < 1.0 EU per μg of the protein
• Purity: >95%
• Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
• Alias: PLAT; TPA; T-PA; Alteplasa; Alteplase; Alteplase (genetical recombination); Alteplase, recombinant; Plasminogen activator (human tissue-type protein moiety); rt-PA; t-PA; t-plasminogen activator; Tissue plasminogen activator; Tissue plasminogen activator alteplase; Tissue plasminogen activator, recombinant

Gene Information

• Gene Name: PLAT plasminogen activator, tissue [ Homo sapiens ]
• Official Symbol: PLAT
• Synonyms: PLAT; plasminogen activator, tissue; tissue-type plasminogen activator; alteplase; reteplase; t-plasminogen activator; plasminogen activator, tissue type; tissue plasminogen activator (t-PA); TPA; T-PA; DKFZp686I03148
• Gene ID: 5327
• mRNA Refseq: NM_000930
• Protein Refseq: NP_000921
• MIM: 173370
• UniProt ID: P00750
• Chromosome Location: 8p11.21
• Pathway: Blood Clotting Cascade, organism-specific biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Dissolution of Fibrin Clot, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Hemostasis, organism-specific biosystem
• Function: peptidase activity; protein binding; serine-type endopeptidase activity; serine-type endopeptidase activity