Recombinant Human PLAG1 protein, GST-tagged

• Cat.No.: PLAG1-301522H
• Product Overview: Recombinant Human PLAG1 (1-75 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Met1-Ser75
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: PLAG1 pleiomorphic adenoma gene 1 [ Homo sapiens ]
• Official Symbol: PLAG1
• Synonyms: PLAG1; pleiomorphic adenoma gene 1; zinc finger protein PLAG1; ZNF912; COL1A2/PLAG1 fusion; PSA; SGPA
• Gene ID: 5324
• mRNA Refseq: NM_001114634
• Protein Refseq: NP_001108106
• MIM: 603026
• UniProt ID: Q6DJT9