Recombinant Human PLAG1 protein, GST-tagged
Cat.No. : | PLAG1-301522H |
Product Overview : | Recombinant Human PLAG1 (1-75 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Ser75 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | PLAG1 pleiomorphic adenoma gene 1 [ Homo sapiens ] |
Official Symbol | PLAG1 |
Synonyms | PLAG1; pleiomorphic adenoma gene 1; zinc finger protein PLAG1; ZNF912; COL1A2/PLAG1 fusion; PSA; SGPA; |
Gene ID | 5324 |
mRNA Refseq | NM_001114634 |
Protein Refseq | NP_001108106 |
MIM | 603026 |
UniProt ID | Q6DJT9 |
◆ Recombinant Proteins | ||
PLAG1-1762H | Recombinant Human PLAG1, His-tagged | +Inquiry |
PLAG1-4153R | Recombinant Rat PLAG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLAG1-2781H | Recombinant Human PLAG1 protein, His-tagged | +Inquiry |
PLAG1-3218C | Recombinant Chicken PLAG1 | +Inquiry |
PLAG1-12909M | Recombinant Mouse PLAG1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAG1-3134HCL | Recombinant Human PLAG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLAG1 Products
Required fields are marked with *
My Review for All PLAG1 Products
Required fields are marked with *
0
Inquiry Basket