Recombinant Human PLAC1 Protein

Cat.No. : PLAC1-07H
Product Overview : Recombinant Human PLAC1 Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 23-212aa
Description : Involved in placenta development. Predicted to be located in extracellular region.
Form : Liquid. In 50mM Tris-HCl, 150mM NaCl, pH 8.0.
Molecular Mass : ~21.3 kDa
AA Sequence : QSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGSM
Purity : >90%
Storage : Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.42 mg/ml
Official Full Name : Placenta enriched 1
Gene Name PLAC1 placenta enriched 1 [ Homo sapiens (human) ]
Official Symbol PLAC1
Synonyms CT92; OOSP2B; OOSP2L
Gene ID 10761
mRNA Refseq NM_001316887
Protein Refseq NP_001303816
MIM 300296
UniProt ID Q9HBJ0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PLAC1 Products

Required fields are marked with *

My Review for All PLAC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon