Recombinant Human PLA2G7, GST-tagged

Cat.No. : PLA2G7-105H
Product Overview : Human PLA2G7 full-length ORF ( AAH38452.1, 22 a.a. - 441 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a secreted enzyme that catalyzes the degradation of platelet-activating factor to biologically inactive products. Defects in this gene are a cause of platelet-activating factor acetylhydrolase deficiency. Two transcript variants encoding the same protein have been found for this gene.
Molecular Mass : 71.72 kDa
AA Sequence : FDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTL WIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHG FIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDIDHGKPVK NALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSEY FQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIGHMLKLKGDIDSNAAIDLSNKASLAFLQKHL GLHKDFDQWDCLIEGDDENLIPGTNINTTNQHIMLQNSSGIEKYN
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PLA2G7 phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma) [ Homo sapiens (human) ]
Official Symbol PLA2G7
Synonyms PLA2G7; PAFAD; PAFAH; LP-PLA2; LDL-PLA2; phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma); platelet-activating factor acetylhydrolase; LDL-PLA(2); gVIIA-PLA2; PAF 2-acylhydrolase; PAF acetylhydrolase; group-VIIA phospholipase A2; LDL-associated phospholipase A2; lipoprotein-associated phospholipase A2; 1-alkyl-2-acetylglycerophosphocholine esterase; 2-acetyl-1-alkylglycerophosphocholine esterase; EC 3.1.1.47
Gene ID 7941
mRNA Refseq NM_001168357
Protein Refseq NP_001161829
MIM 601690
UniProt ID Q13093
Chromosome Location 6p21.2-p12
Pathway Ether lipid metabolism; Lissencephaly gene (LIS1) in neuronal migration and development; Metabolism of proteins
Function 1-alkyl-2-acetylglycerophosphocholine esterase activity; calcium-independent phospholipase A2 activity; phospholipid binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PLA2G7 Products

Required fields are marked with *

My Review for All PLA2G7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon