Recombinant Human PLA2G7, GST-tagged

• Cat.No.: PLA2G7-105H
• Product Overview: Human PLA2G7 full-length ORF ( AAH38452.1, 22 a.a. - 441 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a secreted enzyme that catalyzes the degradation of platelet-activating factor to biologically inactive products. Defects in this gene are a cause of platelet-activating factor acetylhydrolase deficiency. Two transcript variants encoding the same protein have been found for this gene.
• Molecular Mass: 71.72 kDa
• AA Sequence: FDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTL WIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHG FIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDIDHGKPVK NALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSEY FQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIGHMLKLKGDIDSNAAIDLSNKASLAFLQKHL GLHKDFDQWDCLIEGDDENLIPGTNINTTNQHIMLQNSSGIEKYN
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PLA2G7 phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma) [ Homo sapiens (human) ]
• Official Symbol: PLA2G7
• Synonyms: PLA2G7; PAFAD; PAFAH; LP-PLA2; LDL-PLA2; phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma); platelet-activating factor acetylhydrolase; LDL-PLA(2); gVIIA-PLA2; PAF 2-acylhydrolase; PAF acetylhydrolase; group-VIIA phospholipase A2; LDL-associated phospholipase A2; lipoprotein-associated phospholipase A2; 1-alkyl-2-acetylglycerophosphocholine esterase; 2-acetyl-1-alkylglycerophosphocholine esterase; EC 3.1.1.47
• Gene ID: 7941
• mRNA Refseq: NM_001168357
• Protein Refseq: NP_001161829
• MIM: 601690
• UniProt ID: Q13093
• Chromosome Location: 6p21.2-p12
• Pathway: Ether lipid metabolism; Lissencephaly gene (LIS1) in neuronal migration and development; Metabolism of proteins
• Function: 1-alkyl-2-acetylglycerophosphocholine esterase activity; calcium-independent phospholipase A2 activity; phospholipid binding