Recombinant Human PLA2G6 protein, GST-tagged

• Cat.No.: PLA2G6-185H
• Product Overview: Recombinant Human PLA2G6(1 a.a. - 752 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 110.5 kDa
• AA Sequence: MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFRLFQLE LEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENE EGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLH LACQLGKQEMVRVLLLCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIHSKDPRYGASPLHWAKNAEMA RMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHGNTPLHLAMSKDNVEMIKALIVFGAE VDTPNDFGETPTFLASKIGRQLQDLMHISRARKPAFILGSMRDEKRTHDHLLCLDGGGVKGLIIIQLLIAIEKAS GVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGMYFRMKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVRK PKVMLTGTLSDRQPAELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLVWRAARSSGAAPTYFRPNGRFLDGG LLANNPTLDAMTEIHEYNQDLIRKGQANKVKKLSIVVSLGTGRSPQVPVTCVDVFRPSNPWELAKTVFGAKELGK MVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIMLDEVSDTVLVNALWETEVYIYEHREEFQKLIQLLL SP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot(Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 1-752 a.a.

Gene Information

• Gene Name: PLA2G6 phospholipase A2, group VI (cytosolic, calcium-independent) [ Homo sapiens ]
• Official Symbol: PLA2G6
• Synonyms: PLA2G6; phospholipase A2, group VI (cytosolic, calcium-independent); 85 kDa calcium-independent phospholipase A2; iPLA2; PARK14; PNPLA9; GVI PLA2; group VI phospholipase A2; calcium-independent phospholipase A2; patatin-like phospholipase domain containing 9; cytosolic, calcium-independent phospholipase A2; GVI; PLA2; INAD1; NBIA2A; NBIA2B; CaI-PLA2; IPLA2-VIA
• Gene ID: 8398
• mRNA Refseq: NM_001004426
• Protein Refseq: NP_001004426
• MIM: 603604
• UniProt ID: O60733
• Chromosome Location: 22q13.1
• Pathway: Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; Ether lipid metabolism, organism-specific biosystem; Ether lipid metabolism, conserved biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem
• Function: calcium-independent phospholipase A2 activity; hydrolase activity; phospholipase A2 activity