Recombinant Mouse Pla2g12a protein, His&Myc-tagged
Cat.No. : | Pla2g12a-2338M |
Product Overview : | Recombinant Mouse Pla2g12a protein(Q9EPR2)(26-192aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 26-192aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 22.6 kDa |
AA Sequence : | QEQDQTTDWRATLKTIRNGIHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPVPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLSQNVQACETTVELLFDSVIHLGCKPYLDSQRAACWCRYEEKTDL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Pla2g12a phospholipase A2, group XIIA [ Mus musculus ] |
Official Symbol | Pla2g12a |
Synonyms | PLA2G12A; phospholipase A2, group XIIA; group XIIA secretory phospholipase A2; sPLA2-XII; GXII sPLA2; group XII-1 phospholipase A2; group XIIA secreted phospholipase A2; phosphatidylcholine 2-acylhydrolase 12A; GXII; Rossy; Pla2g12; mGXII-1; mGXII-1-PLA2; 2310004B05Rik; MGC58884; |
Gene ID | 66350 |
mRNA Refseq | NM_023196 |
Protein Refseq | NP_075685 |
◆ Recombinant Proteins | ||
PLA2G12A-3270R | Recombinant Rhesus Macaque PLA2G12A Protein, His (Fc)-Avi-tagged | +Inquiry |
Pla2g12a-4794M | Recombinant Mouse Pla2g12a protein, His&Myc-tagged | +Inquiry |
Pla2g12a-4895M | Recombinant Mouse Pla2g12a Protein, Myc/DDK-tagged | +Inquiry |
PLA2G12A-12883M | Recombinant Mouse PLA2G12A Protein | +Inquiry |
Pla2g12a-8261M | Recombinant Mouse Pla2g12a protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G12A-482HCL | Recombinant Human PLA2G12A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pla2g12a Products
Required fields are marked with *
My Review for All Pla2g12a Products
Required fields are marked with *
0
Inquiry Basket