Recombinant Human PKD2 Protein, GST-tagged

Cat.No. : PKD2-19H
Product Overview : Recombinant Human PKD2 Protein(682-923 aa), fused to GST tag, was expressed in E. coli.
Availability April 22, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 682-923 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : DTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAAS
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PKD2 polycystic kidney disease 2 (autosomal dominant) [ Homo sapiens ]
Official Symbol PKD2
Synonyms PKD2; polycystic kidney disease 2 (autosomal dominant); polycystin-2; Pc 2; PC2; PKD4; transient receptor potential cation channel; subfamily P; member 2; TRPP2; R48321; polycystwin; autosomal dominant polycystic kidney disease type II protein; transient receptor potential cation channel, subfamily P, member 2; Pc-2; APKD2; MGC138466; MGC138468;
Gene ID 5311
mRNA Refseq NM_000297
Protein Refseq NP_000288
MIM 173910
UniProt ID Q13563

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PKD2 Products

Required fields are marked with *

My Review for All PKD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon