Recombinant Human PIWIL1 Protein, GST-tagged
Cat.No. : | PIWIL1-33H |
Product Overview : | Human PIWIL1 partial ORF ( NP_004755.2, 431 a.a. - 541 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Source : | Wheat germ |
Species : | Human |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.95 kDa |
AA Sequence : | NDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEAY |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | PIWIL1 piwi-like 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | PIWIL1 |
Synonyms | PIWIL1; piwi-like 1 (Drosophila); piwi (Drosophila) like 1; piwi-like protein 1; HIWI; PIWI; piwi homolog; MIWI |
Gene ID | 9271 |
mRNA Refseq | NM_001190971 |
Protein Refseq | NP_001177900 |
MIM | 605571 |
UniProt ID | Q96J94 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PIWIL1 Products
Required fields are marked with *
My Review for All PIWIL1 Products
Required fields are marked with *
0
Inquiry Basket