Recombinant Human PITPNB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PITPNB-1226H
• Product Overview: PITPNB MS Standard C13 and N15-labeled recombinant protein (NP_036531) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a cytoplasmic protein that catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes. This transfer activity is required for COPI complex-mediated retrograde transport from the Golgi apparatus to the endoplasmic reticulum. Alternative splicing of this gene results in multiple transcript variants.
• Molecular Mass: 31.5 kDa
• AA Sequence: MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PITPNB phosphatidylinositol transfer protein beta [ Homo sapiens (human) ]
• Official Symbol: PITPNB
• Synonyms: PITPNB; phosphatidylinositol transfer protein, beta; phosphatidylinositol transfer protein beta isoform; VIB1B; ptdInsTP beta; PtdIns transfer protein beta; phosphotidylinositol transfer protein, beta; PtdInsTP; PI-TP-beta
• Gene ID: 23760
• mRNA Refseq: NM_012399
• Protein Refseq: NP_036531
• MIM: 606876
• UniProt ID: P48739