Recombinant Human PIN4, His-tagged

• Cat.No.: PIN4-30962TH
• Product Overview: Recombinant full length Human PIN4, isoform 2 with N terminal His tag; 176 amino acids with tag, Predicted MWt 18.8 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 156 amino acids
• Description: This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ribosome biogenesis. The encoded protein may play an additional role in the mitochondria.
• Conjugation: HIS
• Molecular Weight: 18.800kDa inclusive of tags
• Tissue specificity: Isoform 2 is much more stable than isoform 1 (at protein level). Ubiquitous. Isoform 1 and isoform 2 are expressed in kidney, liver, blood vessel, brain, mammary gland, skeletal muscle, small intestine and submandibularis. Isoform 1 transcripts are much m
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
• Sequence Similarities: Belongs to the ppiC/parvulin rotamase family. PIN4 subfamily.Contains 1 PpiC domain.

Gene Information

• Gene Name: PIN4 protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin) [ Homo sapiens ]
• Official Symbol: PIN4
• Synonyms: PIN4; protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin); protein (peptidyl prolyl cis/trans isomerase) NIMA interacting, 4 (parvulin); peptidyl-prolyl cis-trans isomerase NIMA-interacting 4; EPVH; PAR14; PAR17
• Gene ID: 5303
• mRNA Refseq: NM_001170747
• Protein Refseq: NP_001164218
• MIM: 300252
• Uniprot ID: Q9Y237
• Chromosome Location: Xq13.1
• Function: DNA binding; bent DNA binding; double-stranded DNA binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity