Recombinant Human PIN4, His-tagged
| Cat.No. : | PIN4-30962TH |
| Product Overview : | Recombinant full length Human PIN4, isoform 2 with N terminal His tag; 176 amino acids with tag, Predicted MWt 18.8 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ribosome biogenesis. The encoded protein may play an additional role in the mitochondria. |
| Protein length : | 156 amino acids |
| Conjugation : | HIS |
| Molecular Weight : | 18.800kDa inclusive of tags |
| Source : | E. coli |
| Tissue specificity : | Isoform 2 is much more stable than isoform 1 (at protein level). Ubiquitous. Isoform 1 and isoform 2 are expressed in kidney, liver, blood vessel, brain, mammary gland, skeletal muscle, small intestine and submandibularis. Isoform 1 transcripts are much m |
| Form : | Liquid |
| Purity : | by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 8.0 |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK |
| Sequence Similarities : | Belongs to the ppiC/parvulin rotamase family. PIN4 subfamily.Contains 1 PpiC domain. |
| Gene Name | PIN4 protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin) [ Homo sapiens ] |
| Official Symbol | PIN4 |
| Synonyms | PIN4; protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin); protein (peptidyl prolyl cis/trans isomerase) NIMA interacting, 4 (parvulin); peptidyl-prolyl cis-trans isomerase NIMA-interacting 4; EPVH; PAR14; PAR17; |
| Gene ID | 5303 |
| mRNA Refseq | NM_001170747 |
| Protein Refseq | NP_001164218 |
| MIM | 300252 |
| Uniprot ID | Q9Y237 |
| Chromosome Location | Xq13.1 |
| Function | DNA binding; bent DNA binding; double-stranded DNA binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PIN4 Products
Required fields are marked with *
My Review for All PIN4 Products
Required fields are marked with *
0
Inquiry Basket
