Recombinant Human PIM1 protein, GST-tagged
Cat.No. : | PIM1-301405H |
Product Overview : | Recombinant Human PIM1 (244-313 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | His244-Lys313 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | HDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | PIM1 pim-1 oncogene [ Homo sapiens ] |
Official Symbol | PIM1 |
Synonyms | PIM1; pim-1 oncogene; PIM; serine/threonine-protein kinase pim-1; Oncogene PIM1; pim-1 kinase 44 kDa isoform; pim-1 oncogene (proviral integration site 1); proto-oncogene serine/threonine-protein kinase pim-1; |
Gene ID | 5292 |
mRNA Refseq | NM_001243186 |
Protein Refseq | NP_001230115 |
MIM | 164960 |
UniProt ID | P11309 |
◆ Recombinant Proteins | ||
PIM1-145HFL | Active Recombinant Full Length Human PIM1 Protein, N-GST-tagged | +Inquiry |
PIM1-2938HF | Active Recombinant Full Length Human PIM1 Protein, His-tagged | +Inquiry |
PIM1-7906H | Recombinant Human PIM1 protein, His & GST-tagged | +Inquiry |
PIM1-9086Z | Recombinant Zebrafish PIM1 | +Inquiry |
PIM1-2714H | Recombinant Human PIM1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIM1-3181HCL | Recombinant Human PIM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PIM1 Products
Required fields are marked with *
My Review for All PIM1 Products
Required fields are marked with *
0
Inquiry Basket