Recombinant Human PIK3R1 protein, His-tagged

• Cat.No.: PIK3R1-2925H
• Product Overview: Recombinant Human PIK3R1 protein(319-372 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 319-372 aa
• AA Sequence: VRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) [ Homo sapiens ]
• Official Symbol: PIK3R1
• Synonyms: PIK3R1; phosphoinositide-3-kinase, regulatory subunit 1 (alpha); phosphatidylinositol 3-kinase regulatory subunit alpha; GRB1; p85; p85 ALPHA; PI3-kinase subunit p85-alpha; PI3K regulatory subunit alpha; ptdIns-3-kinase regulatory subunit alpha; phosphatidylinositol 3-kinase-associated p-85 alpha; phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha; phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha); p85-ALPHA
• Gene ID: 5295
• mRNA Refseq: NM_001242466
• Protein Refseq: NP_001229395
• MIM: 171833
• UniProt ID: P27986