Recombinant Human PIGU Protein, GST-Tagged

• Cat.No.: PIGU-1325H
• Product Overview: Human PIGU partial ORF (NP_536724, 101 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Cdc91, a predicted integral membrane protein that may function in cell division control. The protein encoded by this gene is the fifth subunit of GPI transamidase that attaches GPI-anchors to proteins. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 32.89 kDa
• AA Sequence: DFNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTILSCVAKSTCAINNT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PIGU phosphatidylinositol glycan anchor biosynthesis, class U [ Homo sapiens ]
• Official Symbol: PIGU
• Synonyms: PIGU; phosphatidylinositol glycan anchor biosynthesis, class U; GAB1; CDC91L1; phosphatidylinositol glycan anchor biosynthesis class U protein; protein CDC91-like 1; GPI transamidase subunit; GPI transamidase component PIG-U; cell division cycle 91-like 1 protein; cell division cycle protein 91-like 1; CDC91 (cell division cycle 91, S. cerevisiae, homolog)-like 1; bA346K17.2; CDC91 cell division cycle 91-like 1 (S. cerevisiae)
• Gene ID: 28869
• mRNA Refseq: NM_080476
• Protein Refseq: NP_536724
• MIM: 608528
• UniProt ID: Q9H490