Recombinant Human PIGU Protein, GST-Tagged
Cat.No. : | PIGU-1325H |
Product Overview : | Human PIGU partial ORF (NP_536724, 101 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Cdc91, a predicted integral membrane protein that may function in cell division control. The protein encoded by this gene is the fifth subunit of GPI transamidase that attaches GPI-anchors to proteins. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 32.89 kDa |
AA Sequence : | DFNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTILSCVAKSTCAINNT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PIGU phosphatidylinositol glycan anchor biosynthesis, class U [ Homo sapiens ] |
Official Symbol | PIGU |
Synonyms | PIGU; phosphatidylinositol glycan anchor biosynthesis, class U; GAB1; CDC91L1; phosphatidylinositol glycan anchor biosynthesis class U protein; protein CDC91-like 1; GPI transamidase subunit; GPI transamidase component PIG-U; cell division cycle 91-like 1 protein; cell division cycle protein 91-like 1; CDC91 (cell division cycle 91, S. cerevisiae, homolog)-like 1; bA346K17.2; CDC91 cell division cycle 91-like 1 (S. cerevisiae) |
Gene ID | 28869 |
mRNA Refseq | NM_080476 |
Protein Refseq | NP_536724 |
MIM | 608528 |
UniProt ID | Q9H490 |
◆ Recombinant Proteins | ||
PIGU-7756Z | Recombinant Zebrafish PIGU | +Inquiry |
PIGU-1325H | Recombinant Human PIGU Protein, GST-Tagged | +Inquiry |
PIGU-4112R | Recombinant Rat PIGU Protein, His (Fc)-Avi-tagged | +Inquiry |
PIGU-4452R | Recombinant Rat PIGU Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PIGU Products
Required fields are marked with *
My Review for All PIGU Products
Required fields are marked with *
0
Inquiry Basket