Recombinant Human PIGP Protein, GST-tagged

• Cat.No.: PIGP-4026H
• Product Overview: Human DSCR5 partial ORF ( NP_710149, 77 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an enzyme involved in the first step of glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. The encoded protein is a component of the GPI-N-acetylglucosaminyltransferase complex that catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI). This gene is located in the Down Syndrome critical region on chromosome 21 and is a candidate for the pathogenesis of Down syndrome. This gene has multiple pseudogenes and is a member of the phosphatidylinositol glycan anchor biosynthesis gene family. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Feb 2016]
• Molecular Mass: 32.12 kDa
• AA Sequence: NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PIGP phosphatidylinositol glycan anchor biosynthesis, class P [ Homo sapiens ]
• Official Symbol: PIGP
• Synonyms: PIGP; phosphatidylinositol glycan anchor biosynthesis, class P; Down syndrome critical region gene 5 , DSCR5, phosphatidylinositol glycan, class P; phosphatidylinositol N-acetylglucosaminyltransferase subunit P; DCRC; DSRC; phosphatidylinositol n acetylglucosaminyltranferase subunit; PIG-P; Down syndrome critical region gene 5; phosphatidylinositol glycan, class P; Down syndrome critical region protein 5; Down syndrome critical region protein C; phosphatidylinositol-glycan biosynthesis class P protein; phosphatidylinositol-n-acetylglucosaminyltranferase subunit; DSCR5; DCRC-S
• Gene ID: 51227
• mRNA Refseq: NM_153681
• Protein Refseq: NP_710148
• MIM: 605938
• UniProt ID: P57054