Recombinant Human PIEZO2 protein(2427-2661aa), His-tagged

• Cat.No.: PIEZO2-31H
• Product Overview: Recombinant Human PIEZO2 protein(Q9H5I5)(2427-2661aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 2427-2661aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 33.3 kDa
• AA Sequence: KSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILSRDNTTKYNSEWWVLNLTGNRIYNPNSQALELVVFNDKVSPPS
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃.

Gene Information

• Gene Name: PIEZO2 piezo type mechanosensitive ion channel component 2 [ Homo sapiens (human) ]
• Official Symbol: PIEZO2
• Synonyms: DA3; DA5; MWKS; DAIPT; PIEZO2; HsT748; HsT771; FAM38B2; C18orf30; C18orf58
• Gene ID: 63895
• mRNA Refseq: NM_001378183
• Protein Refseq: NP_001365112
• MIM: 613629