Recombinant Human PIEZO1 protein, His&Myc-tagged

• Cat.No.: PIEZO1-4643H
• Product Overview: Recombinant Human PIEZO1 protein(Q92508)(2198-2431aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 2198-2431a.a.
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 33.6 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: RSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKVSPPS

Gene Information

• Gene Name: PIEZO1 piezo-type mechanosensitive ion channel component 1 [ Homo sapiens ]
• Official Symbol: PIEZO1
• Synonyms: PIEZO1; piezo-type mechanosensitive ion channel component 1; FAM38A, family with sequence similarity 38, member A; KIAA0233; protein PIEZO1; family with sequence similarity 38, member A; membrane protein induced by beta-amyloid treatment; Mib; FAM38A
• Gene ID: 9780
• mRNA Refseq: NM_001142864
• Protein Refseq: NP_001136336
• MIM: 611184
• UniProt ID: Q92508