Recombinant Human PHPT1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PHPT1-2207H |
Product Overview : | PHPT1 MS Standard C13 and N15-labeled recombinant protein (NP_054891) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an enzyme that catalyzes the reversible dephosphorylation of histidine residues in proteins. It may be involved in the dephosphorylation of G-beta and ATP citrate lyase and in negatively regulating CD4 T lymphocytes by dephosphorylation and inhibition of KCa3.1 channels. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 13.8 kDa |
AA Sequence : | MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PHPT1 phosphohistidine phosphatase 1 [ Homo sapiens (human) ] |
Official Symbol | PHPT1 |
Synonyms | PHPT1; phosphohistidine phosphatase 1; 14 kDa phosphohistidine phosphatase; sex regulated protein janus a; bA216L13.10; CGI 202; DKFZp564M173; HSPC141; phosphohistidine phosphatase 14kDa; PHP14; 1700008C22Rik; protein janus-A homolog; sex-regulated protein janus-a; CGI-202; RP11-216L13.10; |
Gene ID | 29085 |
mRNA Refseq | NM_014172 |
Protein Refseq | NP_054891 |
MIM | 610167 |
UniProt ID | Q9NRX4 |
◆ Recombinant Proteins | ||
PHPT1-1482H | Recombinant Human PHPT1 Protein (1-125 aa), His-tagged | +Inquiry |
PHPT1-753H | Recombinant Human PHPT1 Protein, His-tagged | +Inquiry |
PHPT1-997Z | Recombinant Zebrafish PHPT1 | +Inquiry |
PHPT1-5067C | Recombinant Chicken PHPT1 | +Inquiry |
PHPT1-1692H | Recombinant Human PHPT1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHPT1-3215HCL | Recombinant Human PHPT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PHPT1 Products
Required fields are marked with *
My Review for All PHPT1 Products
Required fields are marked with *
0
Inquiry Basket