Recombinant Human Phospholipase A2, Group IIE, His-tagged

• Cat.No.: PLA2G2E-69H
• Product Overview: Recombinant Human Secreted Phospholipase A2-IIEproduced inE.Coliis manufactured with N-terminal His-Tag. sPLA2-IIE His-Tagged Fusion Protein is 15.8 kDa protein containing 123 amino acid residues of the human secreted phospholipase A2-IIE and 16 additional amino acid residues – His-Tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators. The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense. This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso-PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci.
• Amino Acid Sequence: MRGSHHHHHHGMASHMNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPV DQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECD K AA LCFRRNLGTYNRKYAHYPNKLCTGPTPPC.
• Physical Appearance: Sterile Filtered lyophilized (freeze-dried) powder.
• Purification Method: Ni-NTA affinity chromatography.
• Purity: Greater than 95% as determined by SDS PAGE.
• Formulation: Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH-4.
• Solubility: Add 0.2 ml of 0.1M Acetate buffer pH-4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10μg/ml. In higher concentrations the solubility of this antigen is limited.
• Specificity: The amino acid sequence of the recombinant human Secreted Phospholipase A2-IIE is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-IIE without signal sequence.
• Applications: Western blotting.
• Stability: Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C. The lyophilized protein remains stable until the expiry date when stored at -20°C.

Gene Information

• Gene Name: PLA2G2E phospholipase A2, group IIE [ Homo sapiens ]
• Synonyms: PLA2G2E;Group IIE secretory phospholipase A2;GIIE sPLA2; EC 3.1.1.4; Phosphatidylcholine 2-acylhydrolase GIIE; sPLA(2)-IIE; phospholipase A2, group IIE
• Gene ID: 30814
• mRNA Refseq: NM_014589
• Protein Refseq: NP_055404
• UniProt ID: Q9NZK7
• Chromosome Location: 1p36.13
• Pathway: Arachidonic acid metabolism; Ether lipid metabolism; Fc epsilon RI signaling pathway; Glycerophospholipid metabolism; GnRH signaling pathway; Linoleic acid metabolism; Long-term depression; MAPK signaling pathway; Metabolic pathways; VEGF signaling pathway; Vascular smooth muscle contraction; alpha-Linolenic acid metabolism
• Function: calcium ion binding; phospholipase A2 activity; hydrolase activity