Recombinant Human PHF19, His-tagged
Cat.No. : | PHF19-30329TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-207 of Human PHF19 Isoform 2 with N terminal His tag, Predicted MWt 24 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-207 a.a. |
Conjugation : | HIS |
Tissue specificity : | Isoform 1 is expressed in thymus, heart, lung and kidney. Isoform 2 is predominantly expressed in placenta, skeletal muscle and kidney, whereas isoform 1 is predominantly expressed in liver and peripheral blood leukocytes. Overexpressed in many types of c |
Form : | Lyophilised:Reconstitute with 107 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodiumphosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MENRALDPGTRDSYGATSHLPNKGALAKVKNNFKDLMSKL TEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNS KYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILIC GKCGLGYHQQCHIPIAGSADQPLLTPWFCRRCIFALAV RVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALETDSASATVLGQDL |
Sequence Similarities : | Contains 2 PHD-type zinc fingers. |
Full Length : | Full L. |
Gene Name | PHF19 PHD finger protein 19 [ Homo sapiens ] |
Official Symbol | PHF19 |
Synonyms | PHF19; PHD finger protein 19; DKFZP727G051; MTF2L1; PCL3; polycomb like 3; |
Gene ID | 26147 |
mRNA Refseq | NM_015651 |
Protein Refseq | NP_056466 |
MIM | 609740 |
Uniprot ID | Q5T6S3 |
Chromosome Location | 9q34.11 |
Function | metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
PHF19-30329TH | Recombinant Human PHF19, His-tagged | +Inquiry |
PHF19-6688M | Recombinant Mouse PHF19 Protein, His (Fc)-Avi-tagged | +Inquiry |
PHF19-1680H | Recombinant Human PHF19, GST-tagged | +Inquiry |
PHF19-12723M | Recombinant Mouse PHF19 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHF19-3232HCL | Recombinant Human PHF19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PHF19 Products
Required fields are marked with *
My Review for All PHF19 Products
Required fields are marked with *
0
Inquiry Basket