Recombinant Human PHF11 protein, GST-tagged

• Cat.No.: PHF11-3338H
• Product Overview: Recombinant Human PHF11 protein(Q9UIL8)(1-292aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 60.5 kDa
• Protein length: 1-292aa
• AA Sequence: MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMSSSTSISSLSY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PHF11 PHD finger protein 11 [ Homo sapiens ]
• Official Symbol: PHF11
• Synonyms: PHF11; PHD finger protein 11; BCAP; IgE responsiveness (atopic); IGER; NY REN 34; NY-REN-34 antigen; renal carcinoma antigen NY-REN-34; BRCA1 C-terminus-associated protein; APY; IGEL; IGHER; NYREN34; NY-REN-34; RP11-185C18.3
• Gene ID: 51131
• mRNA Refseq: NM_001040443
• Protein Refseq: NP_001035533
• MIM: 607796
• UniProt ID: Q9UIL8