Recombinant Human PHF1

• Cat.No.: PHF1-30328TH
• Product Overview: Recombinant fragment of Human PHF1 with N terminal proprietary tag; Predicted MWt 36.52 kDa including the tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Description: This gene encodes a Polycomb group protein. The protein is a component of a histone H3 lysine-27 (H3K27)-specific methyltransferase complex, and functions in transcriptional repression of homeotic genes. The protein is also recruited to double-strand breaks, and reduced protein levels results in X-ray sensitivity and increased homologous recombination. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 36.520kDa inclusive of tags
• Tissue specificity: Highest levels in heart, skeletal muscle, and pancreas, lower levels in brain, placenta, lung, liver and kidney.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP
• Sequence Similarities: Contains 2 PHD-type zinc fingers.

Gene Information

• Gene Name: PHF1 PHD finger protein 1 [ Homo sapiens ]
• Official Symbol: PHF1
• Synonyms: PHF1; PHD finger protein 1; MTF2L2
• Gene ID: 5252
• mRNA Refseq: NM_002636
• Protein Refseq: NP_002627
• MIM: 602881
• Uniprot ID: O43189
• Chromosome Location: 6p21.3
• Function: metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding