Recombinant Human PHB Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PHB-1257H
Product Overview : PHB MS Standard C13 and N15-labeled recombinant protein (NP_002625) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene is evolutionarily conserved, and its product is proposed to play a role in human cellular senescence and tumor suppression. Antiproliferative activity is reported to be localized to the 3' UTR, which is proposed to function as a trans-acting regulatory RNA. Several pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 29.6 kDa
AA Sequence : MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PHB prohibitin [ Homo sapiens (human) ]
Official Symbol PHB
Synonyms PHB; prohibitin; PHB1; HEL-215; HEL-S-54e; prohibitin; epididymis luminal protein 215; epididymis secretory sperm binding protein Li 54e
Gene ID 5245
mRNA Refseq NM_002634
Protein Refseq NP_002625
MIM 176705
UniProt ID P35232

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PHB Products

Required fields are marked with *

My Review for All PHB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon