Recombinant Human PGR, StrepII-tagged

• Cat.No.: PGR-228H
• Product Overview: Purified human recombinant progesterone receptor or PR protein (amino acids 412-526, 115 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 11.1 kDa. (Accession NP_000917.3; UniProt P06401) Entrez Gene ID 5241

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 412-526, 115 a.a.
• Description: This product is a fragment of progesterone receptor. PR, a member of the steroid receptor superfamily, mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: AAFPDFPLGPPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPCKAPGAS GCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQ
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: PGR progesterone receptor [ Homo sapiens ]
• Official Symbol: PGR
• Synonyms: PGR; progesterone receptor; NR3C3; PR; nuclear receptor subfamily 3 group C member 3
• Gene ID: 5241
• mRNA Refseq: NM_000926
• Protein Refseq: NP_000917
• MIM: 607311
• UniProt ID: P06401
• Chromosome Location: 11q22-q23
• Pathway: Cellular roles of Anthrax toxin, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem; Nuclear Receptors, organism-specific biosystem; Nuclear signaling by ERBB4, organism-specific biosystem; Oocyte meiosis, organism-specific biosystem
• Function: DNA binding; enzyme binding; ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity; metal ion binding; protein binding; receptor activity; receptor binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; steroid binding; steroid hormone receptor activity; zinc ion binding