Recombinant Human PGR, StrepII-tagged
Cat.No. : | PGR-228H |
Product Overview : | Purified human recombinant progesterone receptor or PR protein (amino acids 412-526, 115 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 11.1 kDa. (Accession NP_000917.3; UniProt P06401) Entrez Gene ID 5241 |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 412-526, 115 a.a. |
Description : | This product is a fragment of progesterone receptor. PR, a member of the steroid receptor superfamily, mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | AAFPDFPLGPPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPCKAPGAS GCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQ |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | PGR progesterone receptor [ Homo sapiens ] |
Official Symbol | PGR |
Synonyms | PGR; progesterone receptor; NR3C3; PR; nuclear receptor subfamily 3 group C member 3; |
Gene ID | 5241 |
mRNA Refseq | NM_000926 |
Protein Refseq | NP_000917 |
MIM | 607311 |
UniProt ID | P06401 |
Chromosome Location | 11q22-q23 |
Pathway | Cellular roles of Anthrax toxin, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem; Nuclear Receptors, organism-specific biosystem; Nuclear signaling by ERBB4, organism-specific biosystem; Oocyte meiosis, organism-specific biosystem; |
Function | DNA binding; enzyme binding; ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity; metal ion binding; protein binding; receptor activity; receptor binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; steroid binding; steroid hormone receptor activity; zinc ion binding; |
◆ Recombinant Proteins | ||
PGR-5861H | Recombinant Human PGR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PGR-3395R | Recombinant Rhesus monkey PGR Protein, His-tagged | +Inquiry |
Pgr-4828M | Recombinant Mouse Pgr Protein, Myc/DDK-tagged | +Inquiry |
PGR-4410R | Recombinant Rat PGR Protein | +Inquiry |
PGR-3213R | Recombinant Rhesus Macaque PGR Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGR Products
Required fields are marked with *
My Review for All PGR Products
Required fields are marked with *
0
Inquiry Basket