Recombinant Human PGLYRP1 protein, His-tagged

• Cat.No.: PGLYRP1-1667H
• Product Overview: Recombinant Human PGLYRP1 protein(1-196 aa), fused with His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 1-196 aa
• AA Sequence: MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PGLYRP1 peptidoglycan recognition protein 1 [ Homo sapiens ]
• Official Symbol: PGLYRP1
• Synonyms: PGLYRP1; peptidoglycan recognition protein 1; peptidoglycan recognition protein , PGLYRP, TNFSF3L; PGRP; PGRP S; PGRPS; TAG7; TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein); PGLYRP; PGRP-S; TNFSF3L; MGC126894; MGC126896
• Gene ID: 8993
• mRNA Refseq: NM_005091
• Protein Refseq: NP_005082
• MIM: 604963
• UniProt ID: O75594