Recombinant Human PGLYRP1 protein, His-tagged
Cat.No. : | PGLYRP1-1667H |
Product Overview : | Recombinant Human PGLYRP1 protein(1-196 aa), fused with His tag, was expressed in E.coli. |
Availability | April 19, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-196 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PGLYRP1 peptidoglycan recognition protein 1 [ Homo sapiens ] |
Official Symbol | PGLYRP1 |
Synonyms | PGLYRP1; peptidoglycan recognition protein 1; peptidoglycan recognition protein , PGLYRP, TNFSF3L; PGRP; PGRP S; PGRPS; TAG7; TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein); PGLYRP; PGRP-S; TNFSF3L; MGC126894; MGC126896; |
Gene ID | 8993 |
mRNA Refseq | NM_005091 |
Protein Refseq | NP_005082 |
MIM | 604963 |
UniProt ID | O75594 |
◆ Recombinant Proteins | ||
PGLYRP1-06H | Active Recombinant Human PGLYRP1 Protein, His-tagged | +Inquiry |
Pglyrp1-3335M | Recombinant Mouse Pglyrp1 protein, His&Myc-tagged | +Inquiry |
PGLYRP1-1312H | Recombinant Human PGLYRP1 Protein, MYC/DDK-tagged | +Inquiry |
PGLYRP1-5268H | Recombinant Human PGLYRP1 Protein (Gln22-Pro196), N-His tagged | +Inquiry |
Pglyrp1-1073R | Recombinant Rat Pglyrp1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGLYRP1-1873MCL | Recombinant Mouse PGLYRP1 cell lysate | +Inquiry |
PGLYRP1-1339HCL | Recombinant Human PGLYRP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGLYRP1 Products
Required fields are marked with *
My Review for All PGLYRP1 Products
Required fields are marked with *
0
Inquiry Basket