Active Recombinant Human PGLYRP1 Protein, His-tagged

• Cat.No.: PGLYRP1-06H
• Product Overview: Recombinant human PGLYRP1, fused to His tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 22-196
• Description: Innate immunity protein that plays several important functions in antimicrobial and antitumor defense systems. Acts as a pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria and thus provides bactericidal activity.
• Form: Liquid
• Bio-activity: Measured by its binding ability in a functional ELISA with Peptidoglycan. The ED50 range ≤ 30 ng/mL.
• Molecular Mass: 20.5kDa (184aa)
• AA Sequence: QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95 % by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL
• Storage Buffer: PBS (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: PGLYRP1 peptidoglycan recognition protein 1 [ Homo sapiens (human) ]
• Official Symbol: PGLYRP1
• Synonyms: PGLYRP1; peptidoglycan recognition protein 1; PGRP; TAG7; PGRPS; PGLYRP; PGRP-S; TNFSF3L; peptidoglycan recognition protein 1; TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein)
• Gene ID: 8993
• mRNA Refseq: NM_005091
• Protein Refseq: NP_005082
• MIM: 604963
• UniProt ID: O75594