Recombinant Human PGF Protein, His-tagged
Cat.No. : | PGF-417H |
Product Overview : | Recombinant human PGF protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 221 |
Description : | This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene. |
Form : | Lyophilized |
Molecular Mass : | 20.2 kDa |
AA Sequence : | MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | PGF placental growth factor [ Homo sapiens (human) ] |
Official Symbol | PGF |
Synonyms | PGF; placental growth factor; PGFL, placental growth factor, vascular endothelial growth factor related protein , placental growth factor like; placenta growth factor; D12S1900; PlGF; PLGF; PlGF 2; SHGC 10760; placental growth factor-like; placental growth factor, vascular endothelial growth factor-related protein; PGFL; PlGF-2; SHGC-10760; |
Gene ID | 5228 |
mRNA Refseq | NM_001207012 |
Protein Refseq | NP_001193941 |
MIM | 601121 |
UniProt ID | P49763 |
◆ Recombinant Proteins | ||
PGF-98H | Recombinant Human Placental Growth Factor | +Inquiry |
PGF-1036M | Recombinant Mouse PGF protein(Met1-Pro158) | +Inquiry |
PGF-102H | Active Recombinant Human PGF Protein | +Inquiry |
PGF-0643H | Recombinant Human PGF protein, GST-tagged | +Inquiry |
PGF-3333H | Recombinant Human PGF protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGF-1118MCL | Recombinant Mouse PGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGF Products
Required fields are marked with *
My Review for All PGF Products
Required fields are marked with *
0
Inquiry Basket