Recombinant Human PGF Protein, His-tagged

• Cat.No.: PGF-417H
• Product Overview: Recombinant human PGF protein with His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 221
• Description: This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.
• Form: Lyophilized
• Molecular Mass: 20.2 kDa
• AA Sequence: MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: PGF placental growth factor [ Homo sapiens (human) ]
• Official Symbol: PGF
• Synonyms: PGF; placental growth factor; PGFL, placental growth factor, vascular endothelial growth factor related protein , placental growth factor like; placenta growth factor; D12S1900; PlGF; PLGF; PlGF 2; SHGC 10760; placental growth factor-like; placental growth factor, vascular endothelial growth factor-related protein; PGFL; PlGF-2; SHGC-10760
• Gene ID: 5228
• mRNA Refseq: NM_001207012
• Protein Refseq: NP_001193941
• MIM: 601121
• UniProt ID: P49763