Recombinant Human PGF protein, hFc-tagged

• Cat.No.: PGF-4635H
• Product Overview: Recombinant Human PGF protein(P49763)(19-170aa), fused with C-terminal hFc tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• Protein Length: 19-170aa
• Tag: C-hFc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 45.1 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Gene Information

• Gene Name: PGF placental growth factor [ Homo sapiens ]
• Official Symbol: PGF
• Synonyms: PGF; placental growth factor; PGFL, placental growth factor, vascular endothelial growth factor related protein , placental growth factor like; placenta growth factor; D12S1900; PlGF; PLGF; PlGF 2; SHGC 10760; placental growth factor-like; placental growth factor, vascular endothelial growth factor-related protein; PGFL; PlGF-2; SHGC-10760
• Gene ID: 5228
• mRNA Refseq: NM_001207012
• Protein Refseq: NP_001193941
• MIM: 601121
• UniProt ID: P49763