Recombinant Human PFN2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PFN2-5918H
• Product Overview: PFN2 MS Standard C13 and N15-labeled recombinant protein (NP_444252) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene.
• Molecular Mass: 15 kDa
• AA Sequence: MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PFN2 profilin 2 [ Homo sapiens (human) ]
• Official Symbol: PFN2
• Synonyms: PFN2; profilin 2; profilin-2; profilin II; PFL; D3S1319E
• Gene ID: 5217
• mRNA Refseq: NM_053024
• Protein Refseq: NP_444252
• MIM: 176590
• UniProt ID: P35080