Recombinant Human PFDN5, His-tagged

• Cat.No.: PFDN5-28100TH
• Product Overview: Recombinant full length Human PFDN5 with N terminal His tag; 174 amino acids with tag, Predicted MWt 19.5 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 154 amino acids
• Description: This gene encodes a member of the prefoldin alpha subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. The encoded protein may also repress the transcriptional activity of the proto-oncogene c-Myc. Alternatively spliced transcript variants encoding different isoforms have been described.
• Conjugation: HIS
• Molecular Weight: 19.500kDa inclusive of tags
• Tissue specificity: Highly expressed in pancreas and skeletal muscle and moderately in other tissues.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 10% Glycerol
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAQSINITELNLPQLEMLKN QLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNE GKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAED AKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMS QKIQQLTALGAAQATAKA
• Sequence Similarities: Belongs to the prefoldin subunit alpha family.

Gene Information

• Gene Name: PFDN5 prefoldin subunit 5 [ Homo sapiens ]
• Official Symbol: PFDN5
• Synonyms: PFDN5; prefoldin subunit 5; prefoldin 5; MM 1; PFD5
• Gene ID: 5204
• mRNA Refseq: NM_002624
• Protein Refseq: NP_002615
• MIM: 604899
• Uniprot ID: Q99471
• Chromosome Location: 12q13.13
• Pathway: Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Prefoldin mediated transfer of substrateto CCT/TriC, organism-specific biosystem; Protein folding, organism-specific biosystem
• Function: protein binding; transcription corepressor activity; unfolded protein binding