Recombinant Human peptidyl arginine deiminase 2 Protein, His-tagged

• Cat.No.: PADI2-001H
• Product Overview: Recombinant Human PADI2 Protein with C-His tag was expressed in E. coli.

Specification

• Description: This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. This enzyme is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis. This gene exists in a cluster with four other paralogous genes.
• Source: E. coli
• Species: Human
• Tag: C-His
• Protein length: 1-115 aa
• Molecular Mass: 12.8 kDa
• AA Sequence: MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAHHHHHHHH
• Endotoxin: < 2 EU/μg by LAL
• Purity: > 95% by SDS-PAGE.
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL
• Storage Buffer: Sterile PBS, pH7.4

Gene Information

• Gene Name: PADI2 peptidyl arginine deiminase 2 [ Homo sapiens (human) ]
• Official Symbol: PADI2
• Synonyms: PADI2; peptidyl arginine deiminase 2; PAD2; PDI2; PAD-H19; protein-arginine deiminase type-2; peptidyl arginine deiminase, type II; protein-arginine deiminase type II; EC 3.5.3.15
• Gene ID: 11240
• mRNA Refseq: NM_007365
• Protein Refseq: NP_031391
• MIM: 607935
• UniProt ID: Q9Y2J8