Recombinant Human peptidyl arginine deiminase 2 Protein, His-tagged
Cat.No. : | PADI2-001H |
Product Overview : | Recombinant Human PADI2 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-115 aa |
Description : | This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. This enzyme is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis. This gene exists in a cluster with four other paralogous genes. |
Tag : | C-His |
Molecular Mass : | 12.8 kDa |
AA Sequence : | MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAHHHHHHHH |
Endotoxin : | < 2 EU/μg by LAL |
Purity : | > 95% by SDS-PAGE. |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1 mg/mL |
Storage Buffer : | Sterile PBS, pH7.4 |
Gene Name | PADI2 peptidyl arginine deiminase 2 [ Homo sapiens (human) ] |
Official Symbol | PADI2 |
Synonyms | PADI2; peptidyl arginine deiminase 2; PAD2; PDI2; PAD-H19; protein-arginine deiminase type-2; peptidyl arginine deiminase, type II; protein-arginine deiminase type II; EC 3.5.3.15 |
Gene ID | 11240 |
mRNA Refseq | NM_007365 |
Protein Refseq | NP_031391 |
MIM | 607935 |
UniProt ID | Q9Y2J8 |
◆ Recombinant Proteins | ||
PADI2-0608M | Recombinant Mouse PADI2 protein, His-tagged | +Inquiry |
PADI2-3099R | Recombinant Rhesus Macaque PADI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PADI2-0150H | Recombinant Human PADI2 Protein (Met1-Pro665), N-TwinStrep-tagged | +Inquiry |
Padi2-0146M | Recombinant Mouse Padi2 Protein (Met1-Pro673), N-TwinStrep-tagged | +Inquiry |
PADI2-102H | Active Recombinant Human PADI2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PADI2 Products
Required fields are marked with *
My Review for All PADI2 Products
Required fields are marked with *
0
Inquiry Basket