Recombinant Human PELP1 protein, His-tagged

• Cat.No.: PELP1-15H
• Product Overview: Recombinant Human PELP1 protein(39-338 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-His
• Protein length: 39-338 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: ESVSGLLQPRTGSAVAPVHPPNRSAPHLPGLMCLLRLHGSVGGAQNLSALGALVSLSNARLSSIKTRFEGLCLLSLLVGESPTELFQQHCVSWLRSIQQVLQTQDPPATMELAVAVLRDLLRYAAQLPALFRDISMNHLPGLLTSLLGLRPECEQSALEGMKACMTYFPRACGSLKGKLASFFLSRVDALSPQLQQLACECYSRLPSLGAGFSQGLKHTESWEQELHSLLASLHTLLGALYEGAETAPVQNEGPGVEMLLSSEDGDAHVLLQLRQRFSGLARCLGLMLSSEFGAPVSVPV
• Purity: 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
  After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: PELP1 proline, glutamate and leucine rich protein 1 [ Homo sapiens ]
• Official Symbol: PELP1
• Synonyms: PELP1; proline, glutamate and leucine rich protein 1; proline, glutamic acid and leucine rich protein 1; proline-, glutamic acid- and leucine-rich protein 1; MNAR; transcription factor HMX3; proline and glutamic acid rich nuclear protein; proline-, glutamic acid-, leucine-rich protein 1; modulator of nongenomic activity of estrogen receptor; modulator of non-genomic activity of estrogen receptor; HMX3; P160
• Gene ID: 27043
• mRNA Refseq: NM_014389
• Protein Refseq: NP_055204
• MIM: 609455
• UniProt ID: Q8IZL8