Recombinant Human PECAM1 protein(631-700 aa), C-His-tagged

• Cat.No.: PECAM1-2665H
• Product Overview: Recombinant Human PECAM1 protein(P16284)(631-700 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 631-700 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 11 kDa
• AASequence: KQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAES
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: PECAM1 platelet/endothelial cell adhesion molecule 1 [ Homo sapiens ]
• Official Symbol: PECAM1
• Synonyms: PECAM1; platelet/endothelial cell adhesion molecule 1; platelet/endothelial cell adhesion molecule; platelet endothelial cell adhesion molecule; CD31; CD31 antigen; PECA1; GPIIA; PECAM-1; endoCAM; CD31/EndoCAM; FLJ34100; FLJ58394
• Gene ID: 5175
• mRNA Refseq: NM_000442
• Protein Refseq: NP_000433
• MIM: 173445
• UniProt ID: P16284