Recombinant Human PECAM1 Protein

• Cat.No.: PECAM1-01H
• Product Overview: Recombinant human PECAM1 protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.
• Molecular Mass: 13 kDa
• AA Sequence: LRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.0 mg/mL
• Storage Buffer: 50 mM Tris-Acetate, pH 7.5, 1 mM EDTA and 10% Glycerol

Gene Information

• Gene Name: PECAM1 platelet and endothelial cell adhesion molecule 1 [ Homo sapiens (human) ]
• Official Symbol: PECAM1
• Synonyms: PECAM1; platelet and endothelial cell adhesion molecule 1; CD31; PECA1; GPIIA'; PECAM-1; endoCAM; CD31/EndoCAM; platelet endothelial cell adhesion molecule; CD31 antigen; platelet endothelial cell adhesion molecule-1
• Gene ID: 5175
• mRNA Refseq: NM_000442
• Protein Refseq: NP_000433
• MIM: 173445
• UniProt ID: P16284