Recombinant Human PECAM1 Protein

Cat.No. : PECAM1-653H
Product Overview : Recombinant Human PECAM1(a.a.625-739) was produced in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : a.a.625-739
Description : The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.
Form : 50mM Tris-Acetate, pH7.5, 1mM EDTA and 10% Glycerol
Molecular Mass : ~13kDa
AA sequence : LRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
Purity : > 95% as determined by SDS-PAGE
Storage : Short Term Storage +4 centigrade, Long Term Storage -20 centigrade. Prepare aliquots and store at -20 centigrade. Avoid freeze/thaw cycles.
Concentration : 1.0 mg/mL
Gene Name PECAM1 platelet/endothelial cell adhesion molecule 1 [ Homo sapiens ]
Official Symbol PECAM1
Synonyms PECAM1; platelet/endothelial cell adhesion molecule 1; platelet/endothelial cell adhesion molecule; platelet endothelial cell adhesion molecule; CD31; CD31 antigen; PECA1; GPIIA; PECAM-1; endoCAM; CD31/EndoCAM; FLJ34100; FLJ58394;
Gene ID 5175
mRNA Refseq NM_000442
Protein Refseq NP_000433
MIM 173445
UniProt ID P16284

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PECAM1 Products

Required fields are marked with *

My Review for All PECAM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon