Recombinant Human PECAM1 Protein

• Cat.No.: PECAM1-653H
• Product Overview: Recombinant Human PECAM1(a.a.625-739) was produced in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: a.a.625-739
• Description: The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.
• Form: 50mM Tris-Acetate, pH7.5, 1mM EDTA and 10% Glycerol
• Molecular Mass: ～13kDa
• AA sequence: LRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
• Purity: > 95% as determined by SDS-PAGE
• Storage: Short Term Storage +4 centigrade, Long Term Storage -20 centigrade. Prepare aliquots and store at -20 centigrade. Avoid freeze/thaw cycles.
• Concentration: 1.0 mg/mL

Gene Information

• Gene Name: PECAM1 platelet/endothelial cell adhesion molecule 1 [ Homo sapiens ]
• Official Symbol: PECAM1
• Synonyms: PECAM1; platelet/endothelial cell adhesion molecule 1; platelet/endothelial cell adhesion molecule; platelet endothelial cell adhesion molecule; CD31; CD31 antigen; PECA1; GPIIA; PECAM-1; endoCAM; CD31/EndoCAM; FLJ34100; FLJ58394
• Gene ID: 5175
• mRNA Refseq: NM_000442
• Protein Refseq: NP_000433
• MIM: 173445
• UniProt ID: P16284