Recombinant Human PEA15 protein, GST-tagged
Cat.No. : | PEA15-4418H |
Product Overview : | Recombinant Human PEA15 protein(Q15121)(1-130aa), fused to N-terminal GST tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-130aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42 kDa |
AA Sequence : | MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PEA15 phosphoprotein enriched in astrocytes 15 [ Homo sapiens ] |
Official Symbol | PEA15 |
Synonyms | PEA15; phosphoprotein enriched in astrocytes 15; astrocytic phosphoprotein PEA-15; HMAT1; homolog of mouse MAT 1 oncogene; HUMMAT1H; MAT1; MAT1H; PEA 15; PED; Phosphoprotein enriched in astrocytes; 15kD; homolog of mouse MAT-1 oncogene; phosphoprotein enriched in diabetes; Phosphoprotein enriched in astrocytes, 15kD; 15 kDa phosphoprotein enriched in astrocytes; PEA-15; |
Gene ID | 8682 |
mRNA Refseq | NM_003768 |
Protein Refseq | NP_003759 |
MIM | 603434 |
UniProt ID | Q15121 |
◆ Recombinant Proteins | ||
PEA15-3367R | Recombinant Rhesus monkey PEA15 Protein, His-tagged | +Inquiry |
PEA15-30834TH | Recombinant Human PEA15 | +Inquiry |
PEA15-30833TH | Recombinant Human PEA15 | +Inquiry |
PEA15-4418H | Recombinant Human PEA15 protein, GST-tagged | +Inquiry |
PEA15-1643H | Recombinant Human PEA15 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEA15-3312HCL | Recombinant Human PEA15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PEA15 Products
Required fields are marked with *
My Review for All PEA15 Products
Required fields are marked with *
0
Inquiry Basket