Recombinant Human PDXK, His-tagged

• Cat.No.: PDXK-29673TH
• Product Overview: Recombinant full length Human PDXK.1 with N terminal His tag; 336 amino acids with tag, Predicted MWt 37.6 kDa.

Specification

• Description: The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
• Protein length: 312 amino acids
• Conjugation: HIS
• Molecular Weight: 37.600kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Ubiquitous. Isoform 3 is detected in adult testis and spermatozoa.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
• Sequence Similarities: Belongs to the pyridoxine kinase family.

Gene Information

• Gene Name: PDXK pyridoxal (pyridoxine, vitamin B6) kinase [ Homo sapiens ]
• Official Symbol: PDXK
• Synonyms: PDXK; pyridoxal (pyridoxine, vitamin B6) kinase; C21orf97, C21orf124, chromosome 21 open reading frame 97 , chromosome 21 open reading frame 124; pyridoxal kinase; FLJ21324; FLJ31940; MGC15873; PKH; PNK; PRED79
• Gene ID: 8566
• mRNA Refseq: NM_003681
• Protein Refseq: NP_003672
• MIM: 179020
• Uniprot ID: O00764
• Chromosome Location: 21q22.3
• Pathway: Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of vitamins and cofactors, organism-specific biosystem; Metabolism of water-soluble vitamins and cofactors, organism-specific biosystem; Vitamin B6 metabolism, organism-specific biosystem
• Function: ATP binding; lithium ion binding; magnesium ion binding; nucleotide binding; potassium ion binding