Recombinant Human PDX1 protein, Arginine-tagged
Cat.No. : | PDX1-147H |
Product Overview : | Recombinant human PDX1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEVPPLAD DPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTR TAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQ DCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPRESGGGGSPQRRRRRRRR RRR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein transduction for pancreatic β-cells in vitro differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | PDX1 pancreatic and duodenal homeobox 1 [ Homo sapiens ] |
Official Symbol | PDX1 |
Synonyms | PDX1; IDX 1; MODY4; PDX 1; somatostatin transcription factor 1; STF 1; IPF-1; IUF-1; glucose-sensitive factor; insulin upstream factor 1; islet/duodenum homeobox-1; GSF; IPF1; IUF1; IDX-1; PDX-1; STF-1; |
Gene ID | 3651 |
mRNA Refseq | NM_000209 |
Protein Refseq | NP_000200 |
MIM | 600733 |
UniProt ID | P52945 |
Chromosome Location | 13q12.1 |
Pathway | Developmental Biology, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem; Regulation of gene expression in beta cells, organism-specific biosystem; Regulation of gene expression in early pancreatic precursor cells, organism-specific biosystem; |
Function | chromatin binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
PDX1-176H | Recombinant Human Pancreatic And Duodenal Homeobox 1 | +Inquiry |
PDX1-12601M | Recombinant Mouse PDX1 Protein | +Inquiry |
PDX1-147H | Recombinant Human PDX1 protein, Arginine-tagged | +Inquiry |
PDX1-6619M | Recombinant Mouse PDX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pdx1-1573M | Recombinant Mouse Pdx1 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDX1-3318HCL | Recombinant Human PDX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDX1 Products
Required fields are marked with *
My Review for All PDX1 Products
Required fields are marked with *
0
Inquiry Basket