Recombinant Human PDSS2 protein, His-tagged

• Cat.No.: PDSS2-3388H
• Product Overview: Recombinant Human PDSS2 protein(1 - 242 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1 - 242 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTKVVELLASALMDLVQGVYHENSTSKESYITDDI
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PDSS2 prenyl (decaprenyl) diphosphate synthase, subunit 2 [ Homo sapiens ]
• Official Symbol: PDSS2
• Synonyms: PDSS2; prenyl (decaprenyl) diphosphate synthase, subunit 2; C6orf210, chromosome 6 open reading frame 210; decaprenyl-diphosphate synthase subunit 2; bA59I9.3; decaprenyl pyrophosphate synthase subunit 2; subunit 2 of decaprenyl diphosphate synthase; decaprenyl pyrophosphate synthetase subunit 2; all-trans-decaprenyl-diphosphate synthase subunit 2; DLP1; hDLP1; C6orf210
• Gene ID: 57107
• mRNA Refseq: NM_020381
• Protein Refseq: NP_065114
• MIM: 610564
• UniProt ID: Q86YH6