Recombinant Human PDILT protein, His-tagged
Cat.No. : | PDILT-3820H |
Product Overview : | Recombinant Human PDILT protein(235-584 aa), fused to His tag, was expressed in E. coli. |
Availability | March 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 235-584 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | KLINDSTNKQELNRVIKQHLTDFVIEYNTENKDLISELHIMSHMLLFVSKSSESYGIIIQHYKLASKEFQNKILFILVDADEPRNGRVFKYFRVTEVDIPSVQILNLSSDARYKMPSDDITYESLKKFGRSFLSKNATKHQSSEEIPKYWDQGLVKQLVGKNFNVVVFDKEKDVFVMFYAPWSKKCKMLFPLLEELGRKYQNHSTIIIAKIDVTANDIQLMYLDRYPFFRLFPSGSQQAVLYKGEHTLKGFSDFLESHIKTKIEDEDELLSVEQNEVIEEEVLAEEKEVPMMRKGLPEQQSPELENMTKYVSKLEEPAGKKKTSEEVVVVVAKPKGPPVQKKKPKVKEEL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PDILT protein disulfide isomerase-like, testis expressed [ Homo sapiens ] |
Official Symbol | PDILT |
Synonyms | PDILT; protein disulfide isomerase-like, testis expressed; protein disulfide-isomerase-like protein of the testis; PDIA7; protein disulfide isomerase family A; member 7; protein disulfide isomerase like protein of the testis; protein disulfide isomerase family A, member 7; protein disulfide isomerase-like protein of the testis; |
Gene ID | 204474 |
mRNA Refseq | NM_174924 |
Protein Refseq | NP_777584 |
UniProt ID | Q8N807 |
◆ Recombinant Proteins | ||
PDILT-4082H | Recombinant Human PDILT Protein (Ser21-Leu584), C-His tagged | +Inquiry |
PDILT-827H | Recombinant Human PDILT Protein, MYC/DDK-tagged | +Inquiry |
PDILT-932H | Recombinant Human PDILT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDILT-4008R | Recombinant Rat PDILT Protein, His (Fc)-Avi-tagged | +Inquiry |
PDILT-3820H | Recombinant Human PDILT protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDILT-476HCL | Recombinant Human PDILT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDILT Products
Required fields are marked with *
My Review for All PDILT Products
Required fields are marked with *
0
Inquiry Basket